SCOPe 2.08: Domain d5tqel_: 5tqe L:

Lineage for d5tqel_ (5tqe L:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Coagulation factor VIIa [57201] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57202] (97 PDB entries)
   Uniprot P08709 108-202 ! Uniprot P08709 107-202

8. Domain d5tqel_: 5tqe L: [329323]
   Other proteins in same PDB: d5tqeh_
   automated match to d1cvwl_
   complexed with 7kq, ca, gol, so4

Details for d5tqel_

PDB Entry: 5tqe, 1.9 Å

PDB Description: factor viia in complex with the inhibitor (5r)-5-[(1-aminoisoquinolin- 6-yl)amino]-19-(cyclopropylsulfonyl)-3-methyl-13-oxa-3,15- diazatricyclo[14.3.1.1~6,10~]henicosa-1(20),6(21),7,9,16,18-hexaene- 4,14-dione

PDB Compounds: (L:) Factor VIIa (Light Chain)

SCOPe Domain Sequences for d5tqel_:

Sequence; same for both SEQRES and ATOM records:

>d5tqel_ g.3.11.1 (L:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
icvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilekr

Timeline for d5tqel_:

• d5tqel_ first appeared in SCOPe 2.06
  
• d5tqel_ appears in SCOPe 2.07