Lineage for d1hncb2 (1hnc B:1-84)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1168419Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 1168582Protein Class mu GST [81359] (3 species)
  7. 1168590Species Human (Homo sapiens) [TaxId:9606] [52867] (15 PDB entries)
    Uniprot P09488 ! Uniprot P28161
  8. 1168631Domain d1hncb2: 1hnc B:1-84 [32910]
    Other proteins in same PDB: d1hnca1, d1hncb1, d1hncc1, d1hncd1
    complexed with gdn

Details for d1hncb2

PDB Entry: 1hnc (more details), 3 Å

PDB Description: crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d1hncb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hncb2 c.47.1.5 (B:1-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgthkitqsnailryiarkhn

SCOPe Domain Coordinates for d1hncb2:

Click to download the PDB-style file with coordinates for d1hncb2.
(The format of our PDB-style files is described here.)

Timeline for d1hncb2: