Lineage for d1hncd1 (1hnc D:85-217)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1089232Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1089233Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1089234Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 1089397Protein Class mu GST [81348] (3 species)
  7. 1089405Species Human (Homo sapiens) [TaxId:9606] [47622] (15 PDB entries)
    Uniprot P09488 P28161
  8. 1089448Domain d1hncd1: 1hnc D:85-217 [17618]
    Other proteins in same PDB: d1hnca2, d1hncb2, d1hncc2, d1hncd2
    complexed with gdn

Details for d1hncd1

PDB Entry: 1hnc (more details), 3 Å

PDB Description: crystal structure of human class mu glutathione transferase gstm2-2: effects of lattice packing on conformational heterogeneity
PDB Compounds: (D:) glutathione s-transferase

SCOPe Domain Sequences for d1hncd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hncd1 a.45.1.1 (D:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgesekeqiredilenqfmdsrmqlaklcydpdfeklkpeylqalpemlklysqflgkq
pwflgdkitfvdfiaydvlernqvfepscldafpnlkdfisrfeglekisaymkssrflp
rpvftkmavfgnk

SCOPe Domain Coordinates for d1hncd1:

Click to download the PDB-style file with coordinates for d1hncd1.
(The format of our PDB-style files is described here.)

Timeline for d1hncd1: