![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
![]() | Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (3 families) ![]() |
![]() | Family d.41.2.0: automated matches [227168] (1 protein) not a true family |
![]() | Protein automated matches [226878] (8 species) not a true protein |
![]() | Species Streptococcus pyogenes [TaxId:1115816] [328856] (1 PDB entry) |
![]() | Domain d5huoc1: 5huo C:6-116 [329012] Other proteins in same PDB: d5huoa2, d5huob2, d5huoc2, d5huoe2, d5huof2, d5huoh2 automated match to d1x1oa1 complexed with so4; mutant |
PDB Entry: 5huo (more details), 2.8 Å
SCOPe Domain Sequences for d5huoc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5huoc1 d.41.2.0 (C:6-116) automated matches {Streptococcus pyogenes [TaxId: 1115816]} tdltpfqiddtlkaalredvhsedystnaifdhhgqakvslfakeagvlagltvfqrvft lfdevtfqnphqfkdgdrltsgdlvleiigsvrslltcervalnflqhlsg
Timeline for d5huoc1: