Lineage for d5huoe1 (5huo E:6-116)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2188935Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2189055Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (3 families) (S)
  5. 2189127Family d.41.2.0: automated matches [227168] (1 protein)
    not a true family
  6. 2189128Protein automated matches [226878] (8 species)
    not a true protein
  7. 2189144Species Streptococcus pyogenes [TaxId:1115816] [328856] (1 PDB entry)
  8. 2189148Domain d5huoe1: 5huo E:6-116 [328975]
    Other proteins in same PDB: d5huoa2, d5huob2, d5huoc2, d5huoe2, d5huof2, d5huoh2
    automated match to d1x1oa1
    complexed with so4; mutant

Details for d5huoe1

PDB Entry: 5huo (more details), 2.8 Å

PDB Description: crystal structure of nadc deletion mutant in c2221 space group
PDB Compounds: (E:) Nicotinate-nucleotide diphosphorylase (Carboxylating)

SCOPe Domain Sequences for d5huoe1:

Sequence, based on SEQRES records: (download)

>d5huoe1 d.41.2.0 (E:6-116) automated matches {Streptococcus pyogenes [TaxId: 1115816]}
tdltpfqiddtlkaalredvhsedystnaifdhhgqakvslfakeagvlagltvfqrvft
lfdevtfqnphqfkdgdrltsgdlvleiigsvrslltcervalnflqhlsg

Sequence, based on observed residues (ATOM records): (download)

>d5huoe1 d.41.2.0 (E:6-116) automated matches {Streptococcus pyogenes [TaxId: 1115816]}
tdltpfqiddtlkaalredvhsedystnaifhhgqakvslfakeagvlagltvfqrvftl
fdevtfqnphqfkdgdrltsgdlvleiigsvrslltcervalnflqhlsg

SCOPe Domain Coordinates for d5huoe1:

Click to download the PDB-style file with coordinates for d5huoe1.
(The format of our PDB-style files is described here.)

Timeline for d5huoe1: