Lineage for d5huoc1 (5huo C:6-116)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2944850Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2944970Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (4 families) (S)
  5. 2945049Family d.41.2.0: automated matches [227168] (1 protein)
    not a true family
  6. 2945050Protein automated matches [226878] (11 species)
    not a true protein
  7. 2945213Species Streptococcus pyogenes [TaxId:1115816] [328856] (1 PDB entry)
  8. 2945216Domain d5huoc1: 5huo C:6-116 [329012]
    Other proteins in same PDB: d5huoa2, d5huob2, d5huoc2, d5huoe2, d5huof2, d5huoh2
    automated match to d1x1oa1
    complexed with so4; mutant

Details for d5huoc1

PDB Entry: 5huo (more details), 2.8 Å

PDB Description: crystal structure of nadc deletion mutant in c2221 space group
PDB Compounds: (C:) Nicotinate-nucleotide diphosphorylase (Carboxylating)

SCOPe Domain Sequences for d5huoc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5huoc1 d.41.2.0 (C:6-116) automated matches {Streptococcus pyogenes [TaxId: 1115816]}
tdltpfqiddtlkaalredvhsedystnaifdhhgqakvslfakeagvlagltvfqrvft
lfdevtfqnphqfkdgdrltsgdlvleiigsvrslltcervalnflqhlsg

SCOPe Domain Coordinates for d5huoc1:

Click to download the PDB-style file with coordinates for d5huoc1.
(The format of our PDB-style files is described here.)

Timeline for d5huoc1: