Lineage for d1gtie2 (1gti E:1-78)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1168056Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1168057Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1168419Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 1168697Protein Class pi GST [81358] (4 species)
  7. 1168794Species Mouse (Mus musculus) [TaxId:10090] [52866] (9 PDB entries)
  8. 1168813Domain d1gtie2: 1gti E:1-78 [32896]
    Other proteins in same PDB: d1gtia1, d1gtib1, d1gtic1, d1gtid1, d1gtie1, d1gtif1
    complexed with gtb

Details for d1gtie2

PDB Entry: 1gti (more details), 3 Å

PDB Description: modified glutathione s-transferase (pi) complexed with s (p- nitrobenzyl)glutathione
PDB Compounds: (E:) glutathione s-transferase

SCOPe Domain Sequences for d1gtie2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gtie2 c.47.1.5 (E:1-78) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]}
ppytivyfpvrgrceamrmlladqgqswkeevvtidtwmqgllkptclygqlpkfedgdl
tlyqsnailrhlgrslgl

SCOPe Domain Coordinates for d1gtie2:

Click to download the PDB-style file with coordinates for d1gtie2.
(The format of our PDB-style files is described here.)

Timeline for d1gtie2: