SCOPe 2.02: Domain d1gtic1: 1gti C:79-209

Lineage for d1gtic1 (1gti C:79-209)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class pi GST [81347] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47621] (9 PDB entries)

8. Domain d1gtic1: 1gti C:79-209 [17600]
   Other proteins in same PDB: d1gtia2, d1gtib2, d1gtic2, d1gtid2, d1gtie2, d1gtif2
   complexed with gtb

Details for d1gtic1

PDB Entry: 1gti, 3 Å

PDB Description: modified glutathione s-transferase (pi) complexed with s (p- nitrobenzyl)glutathione

PDB Compounds: (C:) glutathione s-transferase

SCOPe Domain Sequences for d1gtic1:

Sequence; same for both SEQRES and ATOM records:

>d1gtic1 a.45.1.1 (C:79-209) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]}
ygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvkalpghlkpfetllsqnqg
gkafivgdqisfadynlldlllihqvlapgcldnfpllsayvarlsarpkikaflsspeh
vnrpingngkq

Timeline for d1gtic1:

• d1gtic1 first appeared (with stable ids) in SCOP 1.55
  
• d1gtic1 appears in SCOPe 2.01
  
• d1gtic1 appears in SCOPe 2.03
  
• d1gtic1 appears in the current release, SCOPe 2.08