Class a: All alpha proteins [46456] (284 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
Protein Class pi GST [81347] (4 species) |
Species Mouse (Mus musculus) [TaxId:10090] [47621] (9 PDB entries) |
Domain d1gtic1: 1gti C:79-209 [17600] Other proteins in same PDB: d1gtia2, d1gtib2, d1gtic2, d1gtid2, d1gtie2, d1gtif2 complexed with gtb |
PDB Entry: 1gti (more details), 3 Å
SCOPe Domain Sequences for d1gtic1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gtic1 a.45.1.1 (C:79-209) Class pi GST {Mouse (Mus musculus) [TaxId: 10090]} ygknqreaaqmdmvndgvedlrgkyvtliytnyengkndyvkalpghlkpfetllsqnqg gkafivgdqisfadynlldlllihqvlapgcldnfpllsayvarlsarpkikaflsspeh vnrpingngkq
Timeline for d1gtic1: