Lineage for d5lqeb2 (5lqe B:310-431)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2003386Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2003387Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2003388Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2003401Protein Cyclin A [47956] (2 species)
  7. 2003437Species Human (Homo sapiens) [TaxId:9606] [47957] (81 PDB entries)
    Uniprot P20248 175-432
  8. 2003757Domain d5lqeb2: 5lqe B:310-431 [328109]
    Other proteins in same PDB: d5lqea1, d5lqea2, d5lqec1, d5lqec2
    automated match to d1oi9b2
    complexed with 72l

Details for d5lqeb2

PDB Entry: 5lqe (more details), 2.97 Å

PDB Description: cdk2/cyclin a in complex with compound 73
PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d5lqeb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5lqeb2 a.74.1.1 (B:310-431) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
ln

SCOPe Domain Coordinates for d5lqeb2:

Click to download the PDB-style file with coordinates for d5lqeb2.
(The format of our PDB-style files is described here.)

Timeline for d5lqeb2:

  • d5lqeb2 is new in SCOPe 2.06-stable
  • d5lqeb2 does not appear in SCOPe 2.07