SCOPe 2.06: Domain d5lqed1: 5lqe D:175-309

Lineage for d5lqed1 (5lqe D:175-309)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (81 PDB entries)
   Uniprot P20248 175-432

8. Domain d5lqed1: 5lqe D:175-309 [328052]
   Other proteins in same PDB: d5lqea1, d5lqea2, d5lqec1, d5lqec2
   automated match to d1oi9b1
   complexed with 72l

Details for d5lqed1

PDB Entry: 5lqe, 2.97 Å

PDB Description: cdk2/cyclin a in complex with compound 73

PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d5lqed1:

Sequence; same for both SEQRES and ATOM records:

>d5lqed1 a.74.1.1 (D:175-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
ehlvlkvltfdlaap

Timeline for d5lqed1:

• d5lqed1 is new in SCOPe 2.06-stable
  
• d5lqed1 does not appear in SCOPe 2.07