Lineage for d5ghpb_ (5ghp B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2211445Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2211446Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2211447Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 2211448Protein 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 [103207] (1 species)
  7. 2211449Species Human (Homo sapiens) [TaxId:9606] [103208] (20 PDB entries)
  8. 2211458Domain d5ghpb_: 5ghp B: [327834]
    automated match to d1irya_
    protein/DNA complex; complexed with na; mutant

Details for d5ghpb_

PDB Entry: 5ghp (more details), 1.19 Å

PDB Description: crystal structure of human mth1(g2k/d120a mutant) in complex with 2- oxo-datp
PDB Compounds: (B:) 7,8-dihydro-8-oxoguanine triphosphatase

SCOPe Domain Sequences for d5ghpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ghpb_ d.113.1.1 (B:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]}
mkasrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesglt
vdalhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpda
sywfplllqkkkfhgyfkfqgqdtildytlrevdtv

SCOPe Domain Coordinates for d5ghpb_:

Click to download the PDB-style file with coordinates for d5ghpb_.
(The format of our PDB-style files is described here.)

Timeline for d5ghpb_: