SCOPe 2.08: Domain d5ghpb_: 5ghp B:

Lineage for d5ghpb_ (5ghp B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 [103207] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103208] (79 PDB entries)

8. Domain d5ghpb_: 5ghp B: [327834]
   automated match to d1irya_
   protein/DNA complex; complexed with na; mutant
   has additional insertions and/or extensions that are not grouped together

Details for d5ghpb_

PDB Entry: 5ghp, 1.19 Å

PDB Description: crystal structure of human mth1(g2k/d120a mutant) in complex with 2- oxo-datp

PDB Compounds: (B:) 7,8-dihydro-8-oxoguanine triphosphatase

SCOPe Domain Sequences for d5ghpb_:

Sequence; same for both SEQRES and ATOM records:

>d5ghpb_ d.113.1.1 (B:) 7,8-dihydro-8-oxoguanine triphosphatase Hmth1 {Human (Homo sapiens) [TaxId: 9606]}
mkasrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesglt
vdalhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpda
sywfplllqkkkfhgyfkfqgqdtildytlrevdtv

Timeline for d5ghpb_:

• d5ghpb_ first appeared in SCOPe 2.06
  
• d5ghpb_ appears in SCOPe 2.07