PDB entry 5ghp

View 5ghp on RCSB PDB site
Description: Crystal structure of human MTH1(G2K/D120A mutant) in complex with 2-oxo-dATP
Class: hydrolase
Keywords: alpha-beta-alpha sandwich, hydrolase, DNA damage, DNA repair, DNA replication
Deposited on 2016-06-20, released 2017-01-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-01-04, with a file datestamp of 2016-12-30.
Experiment type: XRAY
Resolution: 1.19 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 7,8-dihydro-8-oxoguanine triphosphatase
  Species: Homo sapiens [TaxId:9606]
  Gene: NUDT1, MTH1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P36639 (0-155)
    • engineered mutation (1)
    • engineered mutation (119)
  Domains in SCOPe 2.06: d5ghpa_
• Chain 'B':
  Compound: 7,8-dihydro-8-oxoguanine triphosphatase
  Species: Homo sapiens [TaxId:9606]
  Gene: NUDT1, MTH1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P36639 (0-155)
    • engineered mutation (1)
    • engineered mutation (119)
  Domains in SCOPe 2.06: d5ghpb_
• Heterogens: NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5ghpA (A:)
  mkasrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesglt
  vdalhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpda
  sywfplllqkkkfhgyfkfqgqdtildytlrevdtv
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5ghpB (B:)
  mkasrlytlvlvlqpqrvllgmkkrgfgagrwngfggkvqegetiedgarrelqeesglt
  vdalhkvgqivfefvgepelmdvhvfctdsiqgtpvesdemrpcwfqldqipfkdmwpda
  sywfplllqkkkfhgyfkfqgqdtildytlrevdtv