SCOPe 2.07: Domain d5kaii1: 5kai i:2-36

Lineage for d5kaii1 (5kai i:2-36)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family)
   automatically mapped to Pfam PF02532

5. Family f.23.37.1: PsbI-like [161042] (1 protein)
   Pfam PF02532

6. Protein Photosystem II reaction center protein I, PsbI [161043] (3 species)

7. Species Thermosynechococcus elongatus [TaxId:197221] [327744] (4 PDB entries)

8. Domain d5kaii1: 5kai i:2-36 [327745]
   Other proteins in same PDB: d5kaia_, d5kaib_, d5kaic_, d5kaid_, d5kaie_, d5kaif_, d5kaih_, d5kaii2, d5kaij_, d5kaik_, d5kail_, d5kaim1, d5kaim2, d5kaio_, d5kait1, d5kait2, d5kaiu_, d5kaiv_, d5kaix_, d5kaiz_
   automated match to d4ub8i_
   complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kaii1

PDB Entry: 5kai, 2.8 Å

PDB Description: nh3-bound rt xfel structure of photosystem ii 500 ms after the 2nd illumination (2f) at 2.8 a resolution

PDB Compounds: (i:) Photosystem II reaction center protein I

SCOPe Domain Sequences for d5kaii1:

Sequence; same for both SEQRES and ATOM records:

>d5kaii1 f.23.37.1 (i:2-36) Photosystem II reaction center protein I, PsbI {Thermosynechococcus elongatus [TaxId: 197221]}
etlkitvyivvtffvllfvfgflsgdparnpkrkd

Timeline for d5kaii1:

• d5kaii1 first appeared in SCOPe 2.06
  
• d5kaii1 appears in the current release, SCOPe 2.08