SCOPe 2.07: Domain d5kaie_: 5kai e:

Lineage for d5kaie_ (5kai e:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family)

5. Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
   Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284

6. Protein automated matches [191000] (6 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [326602] (6 PDB entries)

8. Domain d5kaie_: 5kai e: [327778]
   Other proteins in same PDB: d5kaia_, d5kaib_, d5kaic_, d5kaid_, d5kaih_, d5kaii1, d5kaii2, d5kaij_, d5kaik_, d5kail_, d5kaim1, d5kaim2, d5kaio_, d5kait1, d5kait2, d5kaiu_, d5kaiv_, d5kaix_, d5kaiz_
   automated match to d2axte1
   complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kaie_

PDB Entry: 5kai, 2.8 Å

PDB Description: nh3-bound rt xfel structure of photosystem ii 500 ms after the 2nd illumination (2f) at 2.8 a resolution

PDB Compounds: (e:) Cytochrome b559 subunit alpha

SCOPe Domain Sequences for d5kaie_:

Sequence; same for both SEQRES and ATOM records:

>d5kaie_ f.23.38.1 (e:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
gttgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrs
iplvtdrfeakqqvetfleqlk

Timeline for d5kaie_:

• d5kaie_ first appeared in SCOPe 2.06
  
• d5kaie_ appears in the current release, SCOPe 2.08