SCOPe 2.07: Domain d5kaio_: 5kai o:

Lineage for d5kaio_ (5kai o:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)

4. Superfamily f.4.1: OMPA-like [56925] (5 families)
   forms (8,10) barrel

5. Family f.4.1.4: PsbO-like [161115] (2 proteins)
   Pfam PF01716; MSP

6. Protein automated matches [191004] (2 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [260553] (5 PDB entries)

8. Domain d5kaio_: 5kai o: [327759]
   Other proteins in same PDB: d5kaia_, d5kaib_, d5kaic_, d5kaid_, d5kaie_, d5kaif_, d5kaih_, d5kaii1, d5kaii2, d5kaij_, d5kaik_, d5kail_, d5kaim1, d5kaim2, d5kait1, d5kait2, d5kaiu_, d5kaiv_, d5kaix_, d5kaiz_
   automated match to d4il6o_
   complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kaio_

PDB Entry: 5kai, 2.8 Å

PDB Description: nh3-bound rt xfel structure of photosystem ii 500 ms after the 2nd illumination (2f) at 2.8 a resolution

PDB Compounds: (o:) Photosystem II manganese-stabilizing polypeptide

SCOPe Domain Sequences for d5kaio_:

Sequence; same for both SEQRES and ATOM records:

>d5kaio_ f.4.1.4 (o:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
qtltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqe
aefvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftv
knlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeel
aranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyas
iepa

Timeline for d5kaio_:

• d5kaio_ first appeared in SCOPe 2.06
  
• d5kaio_ appears in the current release, SCOPe 2.08