SCOP 1.59: Domain d1aba__: 1aba -

Lineage for d1aba__ (1aba -)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (12 families)

5. Family c.47.1.1: Thioltransferase [52834] (6 proteins)

6. Protein Glutaredoxin (Thioltransferase) [52843] (5 species)

7. Species Bacteriophage T4 [TaxId:10665] [52844] (4 PDB entries)

8. Domain d1aba__: 1aba - [32760]

Details for d1aba__

PDB Entry: 1aba, 1.45 Å

PDB Description: the structure of oxidized bacteriophage t4 glutaredoxin (thioredoxin). refinement of native and mutant proteins

SCOP Domain Sequences for d1aba__:

Sequence; same for both SEQRES and ATOM records:

>d1aba__ c.47.1.1 (-) Glutaredoxin (Thioltransferase) {Bacteriophage T4}
mfkvygydsnihkcgpcdnakrlltvkkqpfefinimpekgvfddekiaelltklgrdtq
igltmpqvfapdgshiggfdqlreyfk

Timeline for d1aba__:

• d1aba__ first appeared (with stable ids) in SCOP 1.55
  
• d1aba__ appears in SCOP 1.57
  
• d1aba__ appears in SCOP 1.61
  
• d1aba__ appears in the current release, SCOPe 2.08, called d1abaa_