Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) |
Superfamily c.47.1: Thioredoxin-like [52833] (12 families) |
Family c.47.1.1: Thioltransferase [52834] (6 proteins) |
Protein Glutaredoxin (Thioltransferase) [52843] (5 species) |
Species Bacteriophage T4 [TaxId:10665] [52844] (4 PDB entries) |
Domain d1aba__: 1aba - [32760] |
PDB Entry: 1aba (more details), 1.45 Å
SCOP Domain Sequences for d1aba__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aba__ c.47.1.1 (-) Glutaredoxin (Thioltransferase) {Bacteriophage T4} mfkvygydsnihkcgpcdnakrlltvkkqpfefinimpekgvfddekiaelltklgrdtq igltmpqvfapdgshiggfdqlreyfk
Timeline for d1aba__: