Lineage for d1aba__ (1aba -)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 180865Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
  4. 180866Superfamily c.47.1: Thioredoxin-like [52833] (12 families) (S)
  5. 180867Family c.47.1.1: Thioltransferase [52834] (6 proteins)
  6. 180868Protein Glutaredoxin (Thioltransferase) [52843] (5 species)
  7. 180869Species Bacteriophage T4 [TaxId:10665] [52844] (4 PDB entries)
  8. 180870Domain d1aba__: 1aba - [32760]

Details for d1aba__

PDB Entry: 1aba (more details), 1.45 Å

PDB Description: the structure of oxidized bacteriophage t4 glutaredoxin (thioredoxin). refinement of native and mutant proteins

SCOP Domain Sequences for d1aba__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aba__ c.47.1.1 (-) Glutaredoxin (Thioltransferase) {Bacteriophage T4}
mfkvygydsnihkcgpcdnakrlltvkkqpfefinimpekgvfddekiaelltklgrdtq
igltmpqvfapdgshiggfdqlreyfk

SCOP Domain Coordinates for d1aba__:

Click to download the PDB-style file with coordinates for d1aba__.
(The format of our PDB-style files is described here.)

Timeline for d1aba__: