Lineage for d1aba__ (1aba -)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.47: Thioredoxin fold [52832] (3 superfamilies) Superfamily c.47.1: Thioredoxin-like [52833] (10 families) 
Family c.47.1.1: Thioltransferase [52834] (5 proteins) Protein Glutaredoxin (Thioltransferase) [52843] (5 species) Species Bacteriophage T4 [TaxId:10665] [52844] (4 PDB entries) 
Domain d1aba__: 1aba - [32760]
Details for d1aba__
PDB Entry: 1aba (more details), 1.45 Å
PDB Description: the structure of oxidized bacteriophage t4 glutaredoxin (thioredoxin). refinement of native and mutant proteins
SCOP Domain Sequences for d1aba__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aba__ c.47.1.1 (-) Glutaredoxin (Thioltransferase) {Bacteriophage T4}
mfkvygydsnihkcgpcdnakrlltvkkqpfefinimpekgvfddekiaelltklgrdtq
igltmpqvfapdgshiggfdqlreyfk
SCOP Domain Coordinates for d1aba__:
Click to download the PDB-style file with coordinates for d1aba__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1aba__:
- d1aba__ first appeared (with stable ids) in SCOP 1.55
- d1aba__ appears in SCOP 1.59
- d1aba__ appears in the current release, SCOPe 2.08, called d1abaa_
View in 3D