SCOPe 2.08: Domain d5k9kb2: 5k9k B:107-214

Lineage for d5k9kb2 (5k9k B:107-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5k9kb2: 5k9k B:107-214 [327382]
   Other proteins in same PDB: d5k9ka1, d5k9ka2, d5k9kb1, d5k9kf1, d5k9kf2, d5k9kh1, d5k9kh2, d5k9ki1, d5k9ki2, d5k9kl1
   automated match to d1dn0a2
   complexed with nag

Details for d5k9kb2

PDB Entry: 5k9k, 2.97 Å

PDB Description: crystal structure of multidonor hv6-1-class broadly neutralizing influenza a antibody 56.a.09 in complex with hemagglutinin hong kong 1968.

PDB Compounds: (B:) 56.a.09 light chain

SCOPe Domain Sequences for d5k9kb2:

Sequence; same for both SEQRES and ATOM records:

>d5k9kb2 b.1.1.2 (B:107-214) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

Timeline for d5k9kb2:

• d5k9kb2 first appeared in SCOPe 2.06
  
• d5k9kb2 appears in SCOPe 2.07