Lineage for d5k9ki1 (5k9k I:6-328)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775631Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)
  8. 2775919Domain d5k9ki1: 5k9k I:6-328 [327397]
    Other proteins in same PDB: d5k9ka1, d5k9ka2, d5k9kb1, d5k9kb2, d5k9kf2, d5k9kh1, d5k9kh2, d5k9ki2, d5k9kl1, d5k9kl2
    automated match to d1ha0a1
    complexed with nag

Details for d5k9ki1

PDB Entry: 5k9k (more details), 2.97 Å

PDB Description: crystal structure of multidonor hv6-1-class broadly neutralizing influenza a antibody 56.a.09 in complex with hemagglutinin hong kong 1968.
PDB Compounds: (I:) Hemagglutinin

SCOPe Domain Sequences for d5k9ki1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k9ki1 b.19.1.2 (I:6-328) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
ndnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidct
lidallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegf
twtgvtqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhp
stnqeqtslyvqasgrvtvstrrsqqtiipniesrpwvrglssrisiywtivkpgdvlvi
nsngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygac
pkyvkqntlklatgmrnvpekqt

SCOPe Domain Coordinates for d5k9ki1:

Click to download the PDB-style file with coordinates for d5k9ki1.
(The format of our PDB-style files is described here.)

Timeline for d5k9ki1: