SCOPe 2.08: Domain d5k9kf2: 5k9k F:330-501

Lineage for d5k9kf2 (5k9k F:330-501)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (42 species)
   not a true protein

7. Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [327398] (2 PDB entries)

8. Domain d5k9kf2: 5k9k F:330-501 [327401]
   Other proteins in same PDB: d5k9ka1, d5k9ka2, d5k9kb1, d5k9kb2, d5k9kf1, d5k9kh1, d5k9kh2, d5k9ki1, d5k9kl1, d5k9kl2
   automated match to d1ha0a2
   complexed with nag

Details for d5k9kf2

PDB Entry: 5k9k, 2.97 Å

PDB Description: crystal structure of multidonor hv6-1-class broadly neutralizing influenza a antibody 56.a.09 in complex with hemagglutinin hong kong 1968.

PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d5k9kf2:

Sequence; same for both SEQRES and ATOM records:

>d5k9kf2 h.3.1.0 (F:330-501) automated matches {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfq

Timeline for d5k9kf2:

• d5k9kf2 first appeared in SCOPe 2.06
  
• d5k9kf2 appears in SCOPe 2.07