SCOPe 2.08: Domain d5k9kb1: 5k9k B:1-106

Lineage for d5k9kb1 (5k9k B:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d5k9kb1: 5k9k B:1-106 [327381]
   Other proteins in same PDB: d5k9ka1, d5k9ka2, d5k9kb2, d5k9kf1, d5k9kf2, d5k9kh1, d5k9kh2, d5k9ki1, d5k9ki2, d5k9kl2
   automated match to d1dn0a1
   complexed with nag

Details for d5k9kb1

PDB Entry: 5k9k, 2.97 Å

PDB Description: crystal structure of multidonor hv6-1-class broadly neutralizing influenza a antibody 56.a.09 in complex with hemagglutinin hong kong 1968.

PDB Compounds: (B:) 56.a.09 light chain

SCOPe Domain Sequences for d5k9kb1:

Sequence; same for both SEQRES and ATOM records:

>d5k9kb1 b.1.1.1 (B:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtlslspgeratlscrasqsvassylawyqqkpgqaprlliygassratgvp
drfsgsgsgtdfiltisrlepedfavyycqqydgsqytfgqgtklei

Timeline for d5k9kb1:

• d5k9kb1 first appeared in SCOPe 2.06
  
• d5k9kb1 appears in SCOPe 2.07