Lineage for d1boh_1 (1boh 1-149)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily) Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (2 families) 
Family c.46.1.2: Sulfurtransferase (rhodanese) [52827] (2 proteins) Protein Rhodanese [52828] (1 species) Species Cow (Bos taurus) [TaxId:9913] [52829] (7 PDB entries) 
Domain d1boh_1: 1boh 1-149 [32713]
Details for d1boh_1
PDB Entry: 1boh (more details), 2.3 Å
PDB Description: sulfur-substituted rhodanese (orthorhombic form)
SCOP Domain Sequences for d1boh_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1boh_1 c.46.1.2 (1-149) Rhodanese {Cow (Bos taurus)}
vhqvlyralvstkwlaesvragkvgpglrvldaswyspgtrearkeylerhvpgasffdi
eecrdkaspyevmlpseagfadyvgslgisndthvvvydgddlgsfyaprvwwmfrvfgh
rtvsvlnggfrnwlkeghpvtsepsrpep
SCOP Domain Coordinates for d1boh_1:
Click to download the PDB-style file with coordinates for d1boh_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1boh_1:
- d1boh_1 appears in SCOP 1.57
- d1boh_1 appears in the current release, SCOPe 2.08, called d1boha1
View in 3D
