Lineage for d5f2qe_ (5f2q E:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234637Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2234638Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2234639Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2235083Protein automated matches [190329] (9 species)
    not a true protein
  7. 2235089Species Bothrops jararacussu [TaxId:8726] [326863] (1 PDB entry)
  8. 2235094Domain d5f2qe_: 5f2q E: [326969]
    automated match to d1jzna_
    complexed with ca, na

Details for d5f2qe_

PDB Entry: 5f2q (more details), 2.95 Å

PDB Description: c-type lectin from bothrops jararacussu
PDB Compounds: (E:) C-type lectin BJcuL

SCOPe Domain Sequences for d5f2qe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5f2qe_ d.169.1.1 (E:) automated matches {Bothrops jararacussu [TaxId: 8726]}
nncpqdwlpmnglcykifnelkawkdaemfcrkykpgchlasihlygespeiaeyisdyh
kgqsevwiglcdkkkdfswewtdrsctdylswdknqpdhyqnkefcvelvsntgyrlwnd
qvcesknaflcqckf

SCOPe Domain Coordinates for d5f2qe_:

Click to download the PDB-style file with coordinates for d5f2qe_.
(The format of our PDB-style files is described here.)

Timeline for d5f2qe_: