Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.1: C-type lectin domain [56437] (29 proteins) Pfam PF00059 |
Protein automated matches [190329] (9 species) not a true protein |
Species Bothrops jararacussu [TaxId:8726] [326863] (1 PDB entry) |
Domain d5f2qd_: 5f2q D: [326994] automated match to d1jzna_ complexed with ca, na |
PDB Entry: 5f2q (more details), 2.95 Å
SCOPe Domain Sequences for d5f2qd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5f2qd_ d.169.1.1 (D:) automated matches {Bothrops jararacussu [TaxId: 8726]} ncpqdwlpmnglcykifnelkawkdaemfcrkykpgchlasihlygespeiaeyisdyhk gqsevwiglcdkkkdfswewtdrsctdylswdknqpdhyqnkefcvelvsntgyrlwndq vcesknaflcqckf
Timeline for d5f2qd_: