Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Vicugna pacos [TaxId:30538] [189756] (79 PDB entries) |
Domain d5j57b_: 5j57 B: [326948] Other proteins in same PDB: d5j57a_ automated match to d4s11a_ complexed with cl, edo |
PDB Entry: 5j57 (more details), 1.7 Å
SCOPe Domain Sequences for d5j57b_:
Sequence, based on SEQRES records: (download)
>d5j57b_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]} vqlaetggglvepggslrlscaapefrlqyytagwfrqapgkerewvacisagggvtyyt gsvqgrftisrdnakrtvylqmdslkpedtavyscaadleysqimpscrgsygvrgqgtq vtvssah
>d5j57b_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]} vqlaetggglvepggslrlscaapefrlqyytagwfrqaerewvacisagggvtyytgsv qgrftisrdnakrtvylqmdslkpedtavyscaadleysqimpscrgsygvrgqgtqvtv ssah
Timeline for d5j57b_: