SCOPe 2.08: Domain d5j57b_: 5j57 B:

Lineage for d5j57b_ (5j57 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Vicugna pacos [TaxId:30538] [189756] (82 PDB entries)

8. Domain d5j57b_: 5j57 B: [326948]
   Other proteins in same PDB: d5j57a_
   automated match to d4s11a_
   complexed with cl, edo

Details for d5j57b_

PDB Entry: 5j57, 1.7 Å

PDB Description: v5e1-rta complex

PDB Compounds: (B:) VHH single chain antibody V5E1

SCOPe Domain Sequences for d5j57b_:

Sequence, based on SEQRES records:

>d5j57b_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
vqlaetggglvepggslrlscaapefrlqyytagwfrqapgkerewvacisagggvtyyt
gsvqgrftisrdnakrtvylqmdslkpedtavyscaadleysqimpscrgsygvrgqgtq
vtvssah

Sequence, based on observed residues (ATOM records):

>d5j57b_ b.1.1.1 (B:) automated matches {Vicugna pacos [TaxId: 30538]}
vqlaetggglvepggslrlscaapefrlqyytagwfrqaerewvacisagggvtyytgsv
qgrftisrdnakrtvylqmdslkpedtavyscaadleysqimpscrgsygvrgqgtqvtv
ssah

Timeline for d5j57b_:

• d5j57b_ first appeared in SCOPe 2.06
  
• d5j57b_ appears in SCOPe 2.07