Lineage for d5j57a_ (5j57 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2605913Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2605914Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2605915Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 2606016Protein Ricin A-chain [56389] (1 species)
  7. 2606017Species Castor bean (Ricinus communis) [TaxId:3988] [56390] (55 PDB entries)
    Uniprot P06750 28-286
  8. 2606031Domain d5j57a_: 5j57 A: [326946]
    Other proteins in same PDB: d5j57b_
    automated match to d1br6a_
    complexed with cl, edo

Details for d5j57a_

PDB Entry: 5j57 (more details), 1.7 Å

PDB Description: v5e1-rta complex
PDB Compounds: (A:) ricin

SCOPe Domain Sequences for d5j57a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5j57a_ d.165.1.1 (A:) Ricin A-chain {Castor bean (Ricinus communis) [TaxId: 3988]}
kqypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvels
nhaelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggny
drleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqy
iegemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvy
dvsilipiialmvyrcapppssqf

SCOPe Domain Coordinates for d5j57a_:

Click to download the PDB-style file with coordinates for d5j57a_.
(The format of our PDB-style files is described here.)

Timeline for d5j57a_: