| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) ![]() share with the family I the common active site structure with a circularly permuted topology |
| Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins) has an extension to the beta-sheet of 3 antiparallel strands before strand 4 |
| Protein Tyrosine phosphatase [52806] (7 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [52809] (1 PDB entry) receptor protein tyrosine phosphatase alpha, domain 1 |
| Domain d1yfob_: 1yfo B: [32682] |
PDB Entry: 1yfo (more details), 2.25 Å
SCOPe Domain Sequences for d1yfob_:
Sequence, based on SEQRES records: (download)
>d1yfob_ c.45.1.2 (B:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]}
kypplpvdkleeeinrrmaddnklfreefnalpacpiqatceaaskeenkeknryvnilp
ydhsrvhltpvegvpdsdyinasfingyqeknkfiaaqgpkeetvndfwrmiweqntati
vmvtnlkerkeckcaqywpdqgcwtygnvrvsvedvtvlvdytvrkfciqqvgdvtnrkp
qrlitqfhftswpdfgvpftpigmlkflkkvkacnpqyagaivvhcsagvgrtgtfvvid
amldmmhserkvdvygfvsriraqrcqmvqtdmqyvfiyqallehyly
>d1yfob_ c.45.1.2 (B:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]}
kypplpvdkleeeinrrmaddnklfreefnalpacpiqatceaaskeenkeknryvnilp
ydhsrvhltpvegvpdsdyinasfingyqeknkfiaaqgpkeetvndfwrmiweqntati
vmvtnlkerkeckcaqywpdqgcwtygnvrvsvedvtvlvdytvrkfciqqqrlitqfhf
tswpdfgvpftpigmlkflkkvkacnpqyagaivvhcsagvgrtgtfvvidamldmmhse
rkvdvygfvsriraqrcqmvqtdmqyvfiyqallehyly
Timeline for d1yfob_: