Lineage for d1yfob_ (1yfo B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2116263Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2116264Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2116365Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 protein domains)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 2116409Protein Tyrosine phosphatase [52806] (7 species)
  7. 2116553Species Mouse (Mus musculus) [TaxId:10090] [52809] (1 PDB entry)
    receptor protein tyrosine phosphatase alpha, domain 1
  8. 2116555Domain d1yfob_: 1yfo B: [32682]

Details for d1yfob_

PDB Entry: 1yfo (more details), 2.25 Å

PDB Description: receptor protein tyrosine phosphatase alpha, domain 1 from mouse
PDB Compounds: (B:) receptor protein tyrosine phosphatase alpha

SCOPe Domain Sequences for d1yfob_:

Sequence, based on SEQRES records: (download)

>d1yfob_ c.45.1.2 (B:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]}
kypplpvdkleeeinrrmaddnklfreefnalpacpiqatceaaskeenkeknryvnilp
ydhsrvhltpvegvpdsdyinasfingyqeknkfiaaqgpkeetvndfwrmiweqntati
vmvtnlkerkeckcaqywpdqgcwtygnvrvsvedvtvlvdytvrkfciqqvgdvtnrkp
qrlitqfhftswpdfgvpftpigmlkflkkvkacnpqyagaivvhcsagvgrtgtfvvid
amldmmhserkvdvygfvsriraqrcqmvqtdmqyvfiyqallehyly

Sequence, based on observed residues (ATOM records): (download)

>d1yfob_ c.45.1.2 (B:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]}
kypplpvdkleeeinrrmaddnklfreefnalpacpiqatceaaskeenkeknryvnilp
ydhsrvhltpvegvpdsdyinasfingyqeknkfiaaqgpkeetvndfwrmiweqntati
vmvtnlkerkeckcaqywpdqgcwtygnvrvsvedvtvlvdytvrkfciqqqrlitqfhf
tswpdfgvpftpigmlkflkkvkacnpqyagaivvhcsagvgrtgtfvvidamldmmhse
rkvdvygfvsriraqrcqmvqtdmqyvfiyqallehyly

SCOPe Domain Coordinates for d1yfob_:

Click to download the PDB-style file with coordinates for d1yfob_.
(The format of our PDB-style files is described here.)

Timeline for d1yfob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yfoa_