PDB entry 1yfo

View 1yfo on RCSB PDB site
Description: receptor protein tyrosine phosphatase alpha, domain 1 from mouse
Class: hydrolase
Keywords: hydrolase, signal transduction, receptor, glycoprotein, phosphorylation, signal
Deposited on 1996-12-11, released 1997-04-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.184
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: receptor protein tyrosine phosphatase alpha
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18052
      • conflict (29)
      • conflict (66)
    Domains in SCOPe 2.08: d1yfoa_
  • Chain 'B':
    Compound: receptor protein tyrosine phosphatase alpha
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18052
      • conflict (29)
      • conflict (66)
    Domains in SCOPe 2.08: d1yfob_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yfoA (A:)
    spstnrkypplpvdkleeeinrrmaddnklfreefnalpacpiqatceaaskeenkeknr
    yvnilpydhsrvhltpvegvpdsdyinasfingyqeknkfiaaqgpkeetvndfwrmiwe
    qntativmvtnlkerkeckcaqywpdqgcwtygnvrvsvedvtvlvdytvrkfciqqvgd
    vtnrkpqrlitqfhftswpdfgvpftpigmlkflkkvkacnpqyagaivvhcsagvgrtg
    tfvvidamldmmhserkvdvygfvsriraqrcqmvqtdmqyvfiyqallehylygdtele
    vt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yfoA (A:)
    kypplpvdkleeeinrrmaddnklfreefnalpacpiqatceaaskeenkeknryvnilp
    ydhsrvhltpvegvpdsdyinasfingyqeknkfiaaqgpkeetvndfwrmiweqntati
    vmvtnlkerkeckcaqywpdqgcwtygnvrvsvedvtvlvdytvrkfciqqqrlitqfhf
    tswpdfgvpftpigmlkflkkvkacnpqyagaivvhcsagvgrtgtfvvidamldmmhse
    rkvdvygfvsriraqrcqmvqtdmqyvfiyqallehyly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yfoB (B:)
    spstnrkypplpvdkleeeinrrmaddnklfreefnalpacpiqatceaaskeenkeknr
    yvnilpydhsrvhltpvegvpdsdyinasfingyqeknkfiaaqgpkeetvndfwrmiwe
    qntativmvtnlkerkeckcaqywpdqgcwtygnvrvsvedvtvlvdytvrkfciqqvgd
    vtnrkpqrlitqfhftswpdfgvpftpigmlkflkkvkacnpqyagaivvhcsagvgrtg
    tfvvidamldmmhserkvdvygfvsriraqrcqmvqtdmqyvfiyqallehylygdtele
    vt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yfoB (B:)
    kypplpvdkleeeinrrmaddnklfreefnalpacpiqatceaaskeenkeknryvnilp
    ydhsrvhltpvegvpdsdyinasfingyqeknkfiaaqgpkeetvndfwrmiweqntati
    vmvtnlkerkeckcaqywpdqgcwtygnvrvsvedvtvlvdytvrkfciqqqrlitqfhf
    tswpdfgvpftpigmlkflkkvkacnpqyagaivvhcsagvgrtgtfvvidamldmmhse
    rkvdvygfvsriraqrcqmvqtdmqyvfiyqallehyly