Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (3 families) |
Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (3 proteins) |
Protein Tyrosine phosphatase [52806] (6 species) |
Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (24 PDB entries) |
Domain d1bzca_: 1bzc A: [32670] |
PDB Entry: 1bzc (more details), 2.35 Å
SCOP Domain Sequences for d1bzca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bzca_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), 1B} emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp ssvdikkvlldmrkfrmgliqtaeqlrfsylaviegakfimgdssvqdqwkelshed
Timeline for d1bzca_: