Lineage for d1bzca_ (1bzc A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (3 families) 
Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (3 proteins) Protein Tyrosine phosphatase [52806] (6 species) Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (24 PDB entries) 
Domain d1bzca_: 1bzc A: [32670]
Details for d1bzca_
PDB Entry: 1bzc (more details), 2.35 Å
PDB Description: human ptp1b catalytic domain complexed with tpi
SCOP Domain Sequences for d1bzca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bzca_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), 1B}
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
ssvdikkvlldmrkfrmgliqtaeqlrfsylaviegakfimgdssvqdqwkelshed
SCOP Domain Coordinates for d1bzca_:
Click to download the PDB-style file with coordinates for d1bzca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bzca_:
- d1bzca_ appears in SCOP 1.57
- d1bzca_ appears in the current release, SCOPe 2.08
View in 3D