Lineage for d1c87a_ (1c87 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24013Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
  4. 24014Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (3 families) (S)
  5. 24024Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (3 proteins)
  6. 24035Protein Tyrosine phosphatase [52806] (6 species)
  7. 24036Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (24 PDB entries)
  8. 24045Domain d1c87a_: 1c87 A: [32663]

Details for d1c87a_

PDB Entry: 1c87 (more details), 2.1 Å

PDB Description: crystal structure of protein tyrosine phosphatase 1b complexed with 2- (oxalyl-amino-4,7-dihydro-5h-thieno[2,3-c]pyran-3-carboxylic acid

SCOP Domain Sequences for d1c87a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c87a_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), 1B}
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediktyytvrqlelenlttqetreilhfhyttwpd
fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
ssvdikkvlldmrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshed

SCOP Domain Coordinates for d1c87a_:

Click to download the PDB-style file with coordinates for d1c87a_.
(The format of our PDB-style files is described here.)

Timeline for d1c87a_: