Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
Protein Retinal dehydrogenase/reductase 3 [141907] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141908] (15 PDB entries) Uniprot Q9BPX1 4-253 |
Domain d5en4a_: 5en4 A: [326411] automated match to d1ydef_ complexed with 5q6, na, nad |
PDB Entry: 5en4 (more details), 1.52 Å
SCOPe Domain Sequences for d5en4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5en4a_ c.2.1.2 (A:) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} gtryagkvvvvtgggrgigagivrafvnsgarvvicdkdesggraleqelpgavfilcdv tqeddvktlvsetirrfgrldcvvnnaghhpppqrpeetsaqgfrqllelnllgtytltk lalpylrksqgnvinisslvgaigqaqavpyvatkgavtamtkalaldespygvrvncis pgniwtplweelaalmpdpratiregmlaqplgrmgqpaevgaaavflaseanfctgiel lvtggaelgyg
Timeline for d5en4a_: