Lineage for d5llia_ (5lli A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931223Protein Elongin B [54246] (2 species)
  7. 2931224Species Human (Homo sapiens) [TaxId:9606] [54247] (53 PDB entries)
  8. 2931329Domain d5llia_: 5lli A: [326155]
    Other proteins in same PDB: d5llib1, d5llib2, d5llic_, d5llie1, d5llie2, d5llif_, d5llih1, d5llih2, d5llii_, d5llik1, d5llik2, d5llil_
    automated match to d1lqba_
    complexed with 6z3

Details for d5llia_

PDB Entry: 5lli (more details), 2.4 Å

PDB Description: pvhl:elob:eloc in complex with vh298
PDB Compounds: (A:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d5llia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5llia_ d.15.1.1 (A:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvmk

SCOPe Domain Coordinates for d5llia_:

Click to download the PDB-style file with coordinates for d5llia_.
(The format of our PDB-style files is described here.)

Timeline for d5llia_: