Lineage for d5llic_ (5lli C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768790Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 2768791Family b.3.3.1: VHL [49469] (2 proteins)
  6. 2768792Protein VHL [49470] (1 species)
  7. 2768793Species Human (Homo sapiens) [TaxId:9606] [49471] (41 PDB entries)
  8. 2768887Domain d5llic_: 5lli C: [325929]
    Other proteins in same PDB: d5llia_, d5llib1, d5llib2, d5llid_, d5llie1, d5llie2, d5llig_, d5llih1, d5llih2, d5llij_, d5llik1, d5llik2
    automated match to d1lqbc_
    complexed with 6z3

Details for d5llic_

PDB Entry: 5lli (more details), 2.4 Å

PDB Description: pvhl:elob:eloc in complex with vh298
PDB Compounds: (C:) von hippel-lindau disease tumor suppressor

SCOPe Domain Sequences for d5llic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5llic_ b.3.3.1 (C:) VHL {Human (Homo sapiens) [TaxId: 9606]}
vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd
agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv
rslyedledhpnvqkdlerltq

SCOPe Domain Coordinates for d5llic_:

Click to download the PDB-style file with coordinates for d5llic_.
(The format of our PDB-style files is described here.)

Timeline for d5llic_: