Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
Protein Elongin C [54699] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [54700] (56 PDB entries) |
Domain d5llie1: 5lli E:17-112 [325987] Other proteins in same PDB: d5llia_, d5llib2, d5llic_, d5llid_, d5llie2, d5llif_, d5llig_, d5llih2, d5llii_, d5llij_, d5llik2, d5llil_ automated match to d1lm8c_ complexed with 6z3 |
PDB Entry: 5lli (more details), 2.4 Å
SCOPe Domain Sequences for d5llie1:
Sequence, based on SEQRES records: (download)
>d5llie1 d.42.1.1 (E:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy ftykvrytnssteipefpiapeialellmaanfldc
>d5llie1 d.42.1.1 (E:17-112) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsgnetnevnfreipshvlskvcmyftykvr ytnssteipefpiapeialellmaanfldc
Timeline for d5llie1: