Lineage for d5ts2b_ (5ts2 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2468637Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2468823Protein automated matches [190964] (7 species)
    not a true protein
  7. 2468897Species Pseudomonas aeruginosa [TaxId:557722] [326112] (1 PDB entry)
  8. 2468899Domain d5ts2b_: 5ts2 B: [326154]
    Other proteins in same PDB: d5ts2a2, d5ts2c2, d5ts2d2, d5ts2e2, d5ts2f2
    automated match to d4rukb_
    complexed with ca, cl, cod

Details for d5ts2b_

PDB Entry: 5ts2 (more details), 2.3 Å

PDB Description: crystal structure of a phosphopantetheine adenylyltransferase (coad, ppat) from pseudomonas aeruginosa bound to dephospho coenzyme a
PDB Compounds: (B:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d5ts2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ts2b_ c.26.1.3 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 557722]}
mnrvlypgtfdpitkghgdlierasrlfdhviiavaaspkknplfsleqrvalaqevtkh
lpnvevvgfstllahfvkeqkanvflrglravsdfeyefqlanmnrqlapdvesmfltps
ekysfisstlvreiaalggdiskfvhpavadalaerfk

SCOPe Domain Coordinates for d5ts2b_:

Click to download the PDB-style file with coordinates for d5ts2b_.
(The format of our PDB-style files is described here.)

Timeline for d5ts2b_: