Lineage for d4rukb_ (4ruk B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2468637Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2468823Protein automated matches [190964] (7 species)
    not a true protein
  7. 2468878Species Pseudomonas aeruginosa [TaxId:350703] [279626] (4 PDB entries)
  8. 2468880Domain d4rukb_: 4ruk B: [279627]
    automated match to d1gn8a_
    complexed with act, ca, coa, dms, fmt, gol, pop

Details for d4rukb_

PDB Entry: 4ruk (more details), 2.2 Å

PDB Description: crystal structure of phosphoapantetheine adenylyltransferase ppat/coad with coa and pyrophosphate from pseudomonas aeruginosa
PDB Compounds: (B:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d4rukb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rukb_ c.26.1.3 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 350703]}
mnrvlypgtfdpitkghgdlierasrlfdhviiavaaspkknplfsleqrvalaqevtkh
lpnvevvgfstllahfvkeqkanvflrglravsdfeyefqlanmnrqlapdvesmfltps
ekysfisstlvreiaalggdiskfvhpavadalaerfk

SCOPe Domain Coordinates for d4rukb_:

Click to download the PDB-style file with coordinates for d4rukb_.
(The format of our PDB-style files is described here.)

Timeline for d4rukb_: