![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
![]() | Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) |
![]() | Protein automated matches [190964] (7 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:557722] [326112] (1 PDB entry) |
![]() | Domain d5ts2a1: 5ts2 A:1-158 [326144] Other proteins in same PDB: d5ts2a2, d5ts2c2, d5ts2d2, d5ts2e2, d5ts2f2 automated match to d4rukb_ complexed with ca, cl, cod |
PDB Entry: 5ts2 (more details), 2.3 Å
SCOPe Domain Sequences for d5ts2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ts2a1 c.26.1.3 (A:1-158) automated matches {Pseudomonas aeruginosa [TaxId: 557722]} mnrvlypgtfdpitkghgdlierasrlfdhviiavaaspkknplfsleqrvalaqevtkh lpnvevvgfstllahfvkeqkanvflrglravsdfeyefqlanmnrqlapdvesmfltps ekysfisstlvreiaalggdiskfvhpavadalaerfk
Timeline for d5ts2a1: