Lineage for d5l65v_ (5l65 V:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2228665Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries)
  8. 2229803Domain d5l65v_: 5l65 V: [325848]
    Other proteins in same PDB: d5l65a_, d5l65c_, d5l65d_, d5l65e_, d5l65g_, d5l65i_, d5l65j_, d5l65k_, d5l65l_, d5l65n_, d5l65o_, d5l65q_, d5l65r_, d5l65s_, d5l65u_, d5l65w_, d5l65x_, d5l65y_, d5l65z_
    automated match to d4r17h_
    complexed with 3bv, cl, mes, mg

Details for d5l65v_

PDB Entry: 5l65 (more details), 2.9 Å

PDB Description: yeast 20s proteasome with mouse beta5i (1-138) and mouse beta6 (97- 111; 118-133) in complex with carfilzomib
PDB Compounds: (V:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d5l65v_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l65v_ d.153.1.4 (V:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee

SCOPe Domain Coordinates for d5l65v_:

Click to download the PDB-style file with coordinates for d5l65v_.
(The format of our PDB-style files is described here.)

Timeline for d5l65v_: