Lineage for d5l65u_ (5l65 U:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2224887Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species)
    contains an extension to the common fold at the N-terminus
  7. 2224903Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (193 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2226143Domain d5l65u_: 5l65 U: [325611]
    Other proteins in same PDB: d5l65a_, d5l65b_, d5l65c_, d5l65d_, d5l65e_, d5l65f_, d5l65h_, d5l65i_, d5l65j_, d5l65m_, d5l65n_, d5l65o_, d5l65p_, d5l65q_, d5l65r_, d5l65s_, d5l65t_, d5l65v_, d5l65w_, d5l65x_
    automated match to d1g0ug_
    complexed with 3bv, cl, mes, mg

Details for d5l65u_

PDB Entry: 5l65 (more details), 2.9 Å

PDB Description: yeast 20s proteasome with mouse beta5i (1-138) and mouse beta6 (97- 111; 118-133) in complex with carfilzomib
PDB Compounds: (U:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d5l65u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l65u_ d.153.1.4 (U:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs
yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq
raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk
idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae
q

SCOPe Domain Coordinates for d5l65u_:

Click to download the PDB-style file with coordinates for d5l65u_.
(The format of our PDB-style files is described here.)

Timeline for d5l65u_: