Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries) |
Domain d5l65b_: 5l65 B: [325726] Other proteins in same PDB: d5l65a_, d5l65c_, d5l65d_, d5l65e_, d5l65g_, d5l65i_, d5l65j_, d5l65k_, d5l65l_, d5l65n_, d5l65o_, d5l65q_, d5l65r_, d5l65s_, d5l65u_, d5l65w_, d5l65x_, d5l65y_, d5l65z_ automated match to d1z7qc1 complexed with 3bv, cl, mes, mg |
PDB Entry: 5l65 (more details), 2.9 Å
SCOPe Domain Sequences for d5l65b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l65b_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk tgit
Timeline for d5l65b_: