SCOPe 2.07: Domain d5l65d_: 5l65 D:

Lineage for d5l65d_ (5l65 D:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.0: automated matches [191393] (1 protein)
   not a true family

6. Protein automated matches [190509] (19 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)

8. Domain d5l65d_: 5l65 D: [325590]
   Other proteins in same PDB: d5l65a_, d5l65b_, d5l65f_, d5l65g_, d5l65h_, d5l65i_, d5l65j_, d5l65k_, d5l65l_, d5l65m_, d5l65n_, d5l65o_, d5l65p_, d5l65t_, d5l65u_, d5l65v_, d5l65w_, d5l65x_, d5l65y_, d5l65z_
   automated match to d1iruf_
   complexed with 3bv, cl, mes, mg

Details for d5l65d_

PDB Entry: 5l65, 2.9 Å

PDB Description: yeast 20s proteasome with mouse beta5i (1-138) and mouse beta6 (97- 111; 118-133) in complex with carfilzomib

PDB Compounds: (D:) Proteasome subunit alpha type-5

SCOPe Domain Sequences for d5l65d_:

Sequence, based on SEQRES records:

>d5l65d_ d.153.1.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgegas
geerlmsrpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewh
ssltlkeaellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekea
ae

Sequence, based on observed residues (ATOM records):

>d5l65d_ d.153.1.0 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
drgvstfspegrlfqveysleaiklgstaigiatkegvvlgvekratspllesdsiekiv
eidrhigcamsgltadarsmiehartaavthnlyydedinvesltqsvcdlalrfgelms
rpfgvalliaghdaddgyqlfhaepsgtfyrynakaigsgsegaqaellnewhssltlke
aellvlkilkqvmeekldennaqlscitkqdgfkiydnektaelikelkekeaae

Timeline for d5l65d_:

• d5l65d_ first appeared in SCOPe 2.06
  
• d5l65d_ appears in the current release, SCOPe 2.08