Lineage for d5l5xh_ (5l5x H:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2599521Protein automated matches [190144] (14 species)
    not a true protein
  7. 2599790Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)
  8. 2601024Domain d5l5xh_: 5l5x H: [325190]
    Other proteins in same PDB: d5l5xa_, d5l5xc_, d5l5xd_, d5l5xe_, d5l5xg_, d5l5xi_, d5l5xj_, d5l5xk_, d5l5xl_, d5l5xn_, d5l5xo_, d5l5xq_, d5l5xr_, d5l5xs_, d5l5xu_, d5l5xw_, d5l5xx_, d5l5xy_, d5l5xz_
    automated match to d4r17h_
    complexed with 04c, cl, mes, mg

Details for d5l5xh_

PDB Entry: 5l5x (more details), 2.9 Å

PDB Description: yeast 20s proteasome with human beta5c (1-138) and human beta6 (97- 111; 118-133) in complex with onx 0914
PDB Compounds: (H:) Proteasome subunit beta type-2

SCOPe Domain Sequences for d5l5xh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l5xh_ d.153.1.4 (H:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicdiqee

SCOPe Domain Coordinates for d5l5xh_:

Click to download the PDB-style file with coordinates for d5l5xh_.
(The format of our PDB-style files is described here.)

Timeline for d5l5xh_: