Class a: All alpha proteins [46456] (289 folds) |
Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families) |
Family a.69.1.0: automated matches [254233] (1 protein) not a true family |
Protein automated matches [254528] (17 species) not a true protein |
Species Enterococcus hirae [TaxId:768486] [324662] (3 PDB entries) |
Domain d5kncf3: 5knc F:352-455 [324663] Other proteins in same PDB: d5kncd1, d5kncd2, d5knce1, d5knce2, d5kncf1, d5kncf2, d5kncg_ automated match to d3vr2d3 complexed with adp, gol, mg, so4 |
PDB Entry: 5knc (more details), 3.02 Å
SCOPe Domain Sequences for d5kncf3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kncf3 a.69.1.0 (F:352-455) automated matches {Enterococcus hirae [TaxId: 768486]} kdkgtgagktredhaatmnqlfaayaqgkqakelavvlgesalsdidkiyakfaerfene yvnqgfytnrtitetldlgwellamlprtelkrikddlldkylp
Timeline for d5kncf3: