Lineage for d5kncf3 (5knc F:352-455)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717308Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 2717309Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (4 families) (S)
  5. 2717538Family a.69.1.0: automated matches [254233] (1 protein)
    not a true family
  6. 2717539Protein automated matches [254528] (17 species)
    not a true protein
  7. 2717615Species Enterococcus hirae [TaxId:768486] [324662] (7 PDB entries)
  8. 2717624Domain d5kncf3: 5knc F:352-455 [324663]
    Other proteins in same PDB: d5kncd1, d5kncd2, d5knce1, d5knce2, d5kncf1, d5kncf2, d5kncg_
    automated match to d3vr2d3
    complexed with adp, gol, mg, so4

Details for d5kncf3

PDB Entry: 5knc (more details), 3.02 Å

PDB Description: crystal structure of the 3 adp-bound v1 complex
PDB Compounds: (F:) V-type sodium ATPase subunit B

SCOPe Domain Sequences for d5kncf3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kncf3 a.69.1.0 (F:352-455) automated matches {Enterococcus hirae [TaxId: 768486]}
kdkgtgagktredhaatmnqlfaayaqgkqakelavvlgesalsdidkiyakfaerfene
yvnqgfytnrtitetldlgwellamlprtelkrikddlldkylp

SCOPe Domain Coordinates for d5kncf3:

Click to download the PDB-style file with coordinates for d5kncf3.
(The format of our PDB-style files is described here.)

Timeline for d5kncf3: