Class b: All beta proteins [48724] (178 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) automatically mapped to Pfam PF02874 |
Family b.49.1.0: automated matches [254232] (1 protein) not a true family |
Protein automated matches [254527] (17 species) not a true protein |
Species Enterococcus hirae [TaxId:768486] [324658] (3 PDB entries) |
Domain d5kncd1: 5knc D:1-75 [324665] Other proteins in same PDB: d5kncd2, d5kncd3, d5knce2, d5knce3, d5kncf2, d5kncf3, d5kncg_ automated match to d3vr2d1 complexed with adp, gol, mg, so4 |
PDB Entry: 5knc (more details), 3.02 Å
SCOPe Domain Sequences for d5kncd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kncd1 b.49.1.0 (D:1-75) automated matches {Enterococcus hirae [TaxId: 768486]} mikeyrtikevvgplmavekvsgvkyeelievrmqngeirrgqvlevqedkamvqifegt sginlknssvrflgh
Timeline for d5kncd1: