Lineage for d5efdb_ (5efd B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2093694Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2094316Protein automated matches [190057] (26 species)
    not a true protein
  7. 2094340Species Bacillus sp. [TaxId:65673] [187690] (9 PDB entries)
  8. 2094342Domain d5efdb_: 5efd B: [324376]
    automated match to d4qdma_
    complexed with cl, edo, mg, na; mutant

Details for d5efdb_

PDB Entry: 5efd (more details), 1.67 Å

PDB Description: crystal structure of a surface pocket creating mutant (w6a) of an alkali thermostable gh10 xylanase from bacillus sp. ng-27
PDB Compounds: (B:) Beta-xylanase

SCOPe Domain Sequences for d5efdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5efdb_ c.1.8.3 (B:) automated matches {Bacillus sp. [TaxId: 65673]}
vqpfaaqvasladryeesfdigaavephqlngrqgkvlkhhynsivaenamkpislqpee
gvftwdgadaivefarknnmnlrfhtlvwhnqvpdwffldeegnpmveetneakrqanke
lllerlethiktvverykddvtawdvvnevvddgtpnerglresvwyqitgdeyirvafe
tarkyagedaklfindyntevtpkrdhlynlvqdlladgvpidgvghqahiqidwptide
irtsmemfaglgldnqvteldvslygwpprpafptydaipqerfqaqadrynqlfelyee
ldadlssvtfwgiadnhtwlddrareyndgvgkdapfvfdpnyrvkpafwriid

SCOPe Domain Coordinates for d5efdb_:

Click to download the PDB-style file with coordinates for d5efdb_.
(The format of our PDB-style files is described here.)

Timeline for d5efdb_: