Lineage for d4qdma_ (4qdm A:)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.3: beta-glycanases [51487] (27 proteins)
consist of a number of sequence families
Protein automated matches [190057] (26 species)
not a true protein
Species Bacillus sp. [TaxId:65673] [187690] (9 PDB entries) 
Domain d4qdma_: 4qdm A: [272955]
automated match to d2fgla_
complexed with gol, mg, na; mutant
Details for d4qdma_
PDB Entry: 4qdm (more details), 1.96 Å
PDB Description: crystal structure of n-terminal mutant (v1l) of an alkali thermostable gh10 xylanase from bacillus sp. ng-27
PDB Compounds: (A:) alkaline thermostable endoxylanaseSCOPe Domain Sequences for d4qdma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qdma_ c.1.8.3 (A:) automated matches {Bacillus sp. [TaxId: 65673]}
lqpfawqvasladryeesfdigaavephqlngrqgkvlkhhynsivaenamkpislqpee
gvftwdgadaivefarknnmnlrfhtlvwhnqvpdwffldeegnpmveetneakrqanke
lllerlethiktvverykddvtawdvvnevvddgtpnerglresvwyqitgdeyirvafe
tarkyagedaklfindyntevtpkrdhlynlvqdlladgvpidgvghqahiqidwptide
irtsmemfaglgldnqvteldvslygwpprpafptydaipqerfqaqadrynqlfelyee
ldadlssvtfwgiadnhtwlddrareyndgvgkdapfvfdpnyrvkpafwriid
SCOPe Domain Coordinates for d4qdma_:
Click to download the PDB-style file with coordinates for d4qdma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4qdma_:
- d4qdma_ first appeared in SCOPe 2.05
- d4qdma_ appears in SCOPe 2.07
- d4qdma_ appears in the current release, SCOPe 2.08
View in 3D
